PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn025631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 248aa    MW: 27147.4 Da    PI: 5.8139
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn025631genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82239.22.6e-12208270133
      DUF822  70 rkgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa 133
                 +kg+kp+  ae++g+s++++p+ss++ s+  s+++sp++sy++sp+sssf+sps++d++++++ 
  Achn025631  20 EKGCKPT-LAEIGGTSTNITPCSSQNPSPPYSSFPSPIPSYQPSPSSSSFLSPSNFDNNTSSQM 82 
                 59*****.9*************************************************988644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.3E-92181IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MMSFYLSSVK DNQRYYVERE KGCKPTLAEI GGTSTNITPC SSQNPSPPYS SFPSPIPSYQ  60
PSPSSSSFLS PSNFDNNTSS QMFAFLRDVI PSSLPSLRIS NSAPVTPPLS SPTSRPPHKK  120
PNWESIASLN NYPCFAASAP ASPTRCRQFF PATIPECDES DTSTVDSGQW MSFQTFAPAM  180
IPTSPTFNLV RPLAQRVYPM DAMTDQKGKR PEFEFENIPV KAWEGERIHE VGLDDLGLTL  240
GTGKTQN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-89PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3074e-80BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH779e-83A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000715854e-79(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.27e-51BES1 family protein